Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus somnus Disulfide bond formation protein B(dsbB)

Recombinant Haemophilus somnus Disulfide bond formation protein B(dsbB)

SKU:CSB-CF605113HAAD

Regular price ¥271,800 JPY
Regular price Sale price ¥271,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus somnus (strain 129Pt) (Histophilus somni (strain 129Pt))

Uniprot NO.:Q0I309

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLIFFKNLSMKRSTWILLFISALVLESTALYFQHGMGLNPCVMCIYERVAILGILFSGLI GCIAPKWLVLRILALLIGLGSAVKGLLLAIKHLDYQINVYPWNQCAMVPDFPQTLPLDKW FPNIFMPSGSCSDITWSFLGFSMVQWIIVIFACYFLFFIILSISQFKKVRKNRMLFR

Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase

Gene Names:Name:dsbB Ordered Locus Names:HS_0624

Expression Region:1-177

Sequence Info:full length protein

View full details