Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus phage HP1 Uncharacterized 11.1 kDa protein in rep-hol intergenic region

Recombinant Haemophilus phage HP1 Uncharacterized 11.1 kDa protein in rep-hol intergenic region

SKU:CSB-CF344733HAN

Regular price ¥257,400 JPY
Regular price Sale price ¥257,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus phage HP1 (Bacteriophage HP1)

Uniprot NO.:P51712

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKRKQKQISRILAAKRAEKCGQINAELQETGEYLEGRVHLLRAKLSINGINLKAYVLEQ VINIKHQIVTERFGNVLLGLASGMIGGIIGMFMWVLCIL

Protein Names:Recommended name: Uncharacterized 11.1 kDa protein in rep-hol intergenic region Alternative name(s): ORF10

Gene Names:

Expression Region:1-99

Sequence Info:full length protein

View full details