Gene Bio Systems
Recombinant Haemophilus influenzae UPF0299 membrane protein NTHI1827(NTHI1827)
Recombinant Haemophilus influenzae UPF0299 membrane protein NTHI1827(NTHI1827)
SKU:CSB-CF683870HAAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus influenzae (strain 86-028NP)
Uniprot NO.:Q4QK50
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIQKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRRENQVKQAN
Protein Names:Recommended name: UPF0299 membrane protein NTHI1827
Gene Names:Ordered Locus Names:NTHI1827
Expression Region:1-140
Sequence Info:full length protein
