Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae UPF0208 membrane protein CGSHiEE_06015 (CGSHiEE_06015)

Recombinant Haemophilus influenzae UPF0208 membrane protein CGSHiEE_06015 (CGSHiEE_06015)

SKU:CSB-CF403224HSD

Regular price ¥267,400 JPY
Regular price Sale price ¥267,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain PittEE)

Uniprot NO.:A5UCQ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFFSIFKQGQIYLNTWPQEAKLGIIFPENRIMKATSFAQKFMPFVAVFAILWQQIYAKN DLMAFSIAILTALFALLIPFQGLYWLGKRANSPLENQSAVWFYDICERLKQQNEPLPFVQ EKPTYQHLAEVLRKAQSKFERAFWQEI

Protein Names:Recommended name: UPF0208 membrane protein CGSHiEE_06015

Gene Names:Ordered Locus Names:CGSHiEE_06015

Expression Region:1-147

Sequence Info:full length protein

View full details