Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae UPF0114 protein NTHI0635(NTHI0635)

Recombinant Haemophilus influenzae UPF0114 protein NTHI0635(NTHI0635)

SKU:CSB-CF703053HAAA

Regular price ¥273,600 JPY
Regular price Sale price ¥273,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain 86-028NP)

Uniprot NO.:Q4QN39

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINV NDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH

Protein Names:Recommended name: UPF0114 protein NTHI0635

Gene Names:Ordered Locus Names:NTHI0635

Expression Region:1-183

Sequence Info:full length protein

View full details