Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae UPF0114 protein CGSHiGG_05795 (CGSHiGG_05795)

Recombinant Haemophilus influenzae UPF0114 protein CGSHiGG_05795 (CGSHiGG_05795)

SKU:CSB-CF404082HSE

Regular price ¥274,300 JPY
Regular price Sale price ¥274,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain PittGG)

Uniprot NO.:A5UH14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWALVINV NDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH

Protein Names:Recommended name: UPF0114 protein CGSHiGG_05795

Gene Names:Ordered Locus Names:CGSHiGG_05795

Expression Region:1-183

Sequence Info:full length protein

View full details