Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae Putative metal transport protein HI_1621 (HI_1621)

Recombinant Haemophilus influenzae Putative metal transport protein HI_1621 (HI_1621)

SKU:CSB-CF332167HTA

Regular price ¥271,100 JPY
Regular price Sale price ¥271,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Uniprot NO.:P44274

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHLSEGVLHTPILLAGAVLAVAGIAVGLRRLESERLPLTALFAAAFFVAGTIHVPVGIGS VHLILNGMAGLFLGWAVFPAFLIALLLQVIFFSFGGFAVLGVNLCVMATPAVIAHYLFRS RLQPQMALKDRLLVGIGAGVIGVGGAGALASFVLMLDGGKSYLNLVWLLLVSHIPVFILD SIISVGVITLLGKMYPEVMNRTENFS

Protein Names:Recommended name: Putative metal transport protein HI_1621

Gene Names:Ordered Locus Names:HI_1621

Expression Region:1-206

Sequence Info:full length protein

View full details