Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae Probable intracellular septation protein A (CGSHiEE_07930)

Recombinant Haemophilus influenzae Probable intracellular septation protein A (CGSHiEE_07930)

SKU:CSB-CF402953HSD

Regular price ¥274,600 JPY
Regular price Sale price ¥274,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain PittEE)

Uniprot NO.:A5UDP8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQLLDFIPLILFFITYKLGGVREAAIVLVVATILQIVILKWKYGTVEKQQKIMASAVVF FGLLTAYFNEIRYLQWKVTIINGLFAIVLLIAQFQFKTPLIKKLLGKELQLPEKAWNTLN FGWAIFFIICMLVNIYISHNMSEEAWVDFKSFGIIGMTVIATIISGVYIYRYLPKDGSNS KDGEK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:CGSHiEE_07930

Expression Region:1-185

Sequence Info:full length protein

View full details