Skip to product information
1 of 1

Gene Bio Systems

Recombinant Guizotia abyssinica ATP synthase subunit b, chloroplastic(atpF)

Recombinant Guizotia abyssinica ATP synthase subunit b, chloroplastic(atpF)

SKU:CSB-CF452645GHI

Regular price ¥273,500 JPY
Regular price Sale price ¥273,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Guizotia abyssinica (Niger) (Ramtilla)

Uniprot NO.:B2LMI6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNVTDSFVSLGHWPSAGSFGFNTDILATNLINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARARLRKVEIEADEFRVNGYSEIEREKLNLIDSTYKTLEQ LENYKNETINFEQQKASNQVRQRVFQQALQGALGTLNSCLNNELHLRTISANIGILAAMK QITD

Protein Names:Recommended name: ATP synthase subunit b, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I

Gene Names:Name:atpF Ordered Locus Names:GuabCp014

Expression Region:1-184

Sequence Info:full length protein

View full details