Skip to product information
1 of 1

Gene Bio Systems

Recombinant Guinea pig Potassium voltage-gated channel subfamily H member 2(KCNH2)

Recombinant Guinea pig Potassium voltage-gated channel subfamily H member 2(KCNH2)

SKU:CSB-CF012036GU

Regular price ¥270,200 JPY
Regular price Sale price ¥270,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cavia porcellus (Guinea pig)

Uniprot NO.:O08703

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AVWDWLILLLVIYTAVFTPYSAAFLLKEPEEDAQTADCGYACQPLAVVDLIVDIMFIVDI LINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTA RLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY

Protein Names:Recommended name: Potassium voltage-gated channel subfamily H member 2 Alternative name(s): Ether-a-go-go-related gene potassium channel 1 Short name= ERG-1 Short name= Eag-related protein 1 Short name= Ether-a-go-go-related p

Gene Names:Name:KCNH2 Synonyms:ERG

Expression Region:1-162

Sequence Info:Full length protein

View full details