Recombinant Guinea pig Potassium voltage-gated channel subfamily E member 2(Kcne2)

SKU: CSB-CF012027GU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cavia porcellus (Guinea pig)

Uniprot NO.:P63160

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP

Protein Names:Recommended name: Potassium voltage-gated channel subfamily E member 2 Alternative name(s): MinK-related peptide 1 Minimum potassium ion channel-related peptide 1 Potassium channel subunit beta MiRP1

Gene Names:Name:Kcne2

Expression Region:1-123

Sequence Info:full length protein