Skip to product information
1 of 1

Gene Bio Systems

Recombinant Guinea pig Mu-type opioid receptor(OPRM1)

Recombinant Guinea pig Mu-type opioid receptor(OPRM1)

SKU:CSB-CF016361GU

Regular price ¥252,900 JPY
Regular price Sale price ¥252,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cavia porcellus (Guinea pig)

Uniprot NO.:P97266

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI

Protein Names:Recommended name: Mu-type opioid receptor Short name= M-OR-1 Short name= MOR-1

Gene Names:Name:OPRM1

Expression Region:1-98

Sequence Info:full length protein

View full details