Gene Bio Systems
Recombinant Guinea pig Mu-type opioid receptor(OPRM1)
Recombinant Guinea pig Mu-type opioid receptor(OPRM1)
SKU:CSB-CF016361GU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Cavia porcellus (Guinea pig)
Uniprot NO.:P97266
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Protein Names:Recommended name: Mu-type opioid receptor Short name= M-OR-1 Short name= MOR-1
Gene Names:Name:OPRM1
Expression Region:1-98
Sequence Info:full length protein
