Skip to product information
1 of 1

Gene Bio Systems

Recombinant Guinea pig Brain protein I3(I3)

Recombinant Guinea pig Brain protein I3(I3)

SKU:CSB-CF002811GU

Regular price ¥261,900 JPY
Regular price Sale price ¥261,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cavia porcellus (Guinea pig)

Uniprot NO.:Q99N46

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDHKPLLQERPPAYNLEAGQGDYACGAPGYGAIPSAPPPPPYPYLVTGIPTPHPRVYSIH SRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNC GATFT

Protein Names:Recommended name: Brain protein I3

Gene Names:Name:I3

Expression Region:1-125

Sequence Info:full length protein

View full details