Skip to product information
1 of 1

Gene Bio Systems

Recombinant Glycine max P24 oleosin isoform A

Recombinant Glycine max P24 oleosin isoform A

SKU:CSB-CF329917GGV

Regular price ¥274,600 JPY
Regular price Sale price ¥274,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Glycine max (Soybean) (Glycine hispida)

Uniprot NO.:P29530

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTQVPPHSVQVHTTTTHRYEAGVVPPGARFETSYEAGVKAASIYHSERGPTTSQVLAVL AGLPVGGILLLLAGLTLAGTLTGLAVATPLFVLFSPVLVPATVAIGLAVAGFLTSGAFGL TALSSFSWILNYIRETQPASENLAAAAKHHLAEAAEYVGQKTKEVGQKTKEVGQDIQSKA QDTREAAARDAREAAARDAREAAARDAKVEARDVKRTTVTATTATA

Protein Names:Recommended name: P24 oleosin isoform A Alternative name(s): P89

Gene Names:

Expression Region:1-226

Sequence Info:full length protein

View full details