Skip to product information
1 of 1

Gene Bio Systems

Recombinant Glutamate-aspartate transport system permease protein gltK(gltK)

Recombinant Glutamate-aspartate transport system permease protein gltK(gltK)

SKU:CSB-CF365186EGX

Regular price ¥273,500 JPY
Regular price Sale price ¥273,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O6

Uniprot NO.:P0AER6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYV NVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGI QSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADF FRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA

Protein Names:Recommended name: Glutamate/aspartate transport system permease protein gltK

Gene Names:Name:gltK Ordered Locus Names:c0737

Expression Region:1-224

Sequence Info:full length protein

View full details