Gene Bio Systems
Recombinant Gluconobacter oxydans Glycerol dehydrogenase small subunit(sldB)
Recombinant Gluconobacter oxydans Glycerol dehydrogenase small subunit(sldB)
SKU:CSB-CF741100GGU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)
Uniprot NO.:Q70JP0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPNTYGSRTLTEWLTLVLGVVIILVGLFFVIAGADLAMLGGSVYYVICGIPLVAGGVFML MGRTLGAFLYLGALAYTWVWSLWEVGFSPVDLLPRDFGPTLLGILVALTIPVLRRMETRR TLRGTV
Protein Names:Recommended name: Glycerol dehydrogenase small subunit EC= 1.1.99.22 Alternative name(s): D-arabitol dehydrogenase small subunit Short name= ARDH D-sorbitol dehydrogenase subunit sldB Short name= SLDH Gluconate/polyol
Gene Names:Name:sldB Synonyms:g5dhA Ordered Locus Names:GOX0855
Expression Region:1-126
Sequence Info:full length protein
