Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gluconobacter oxydans Glycerol dehydrogenase small subunit(sldB)

Recombinant Gluconobacter oxydans Glycerol dehydrogenase small subunit(sldB)

SKU:CSB-CF741100GGU

Regular price ¥262,300 JPY
Regular price Sale price ¥262,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)

Uniprot NO.:Q70JP0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPNTYGSRTLTEWLTLVLGVVIILVGLFFVIAGADLAMLGGSVYYVICGIPLVAGGVFML MGRTLGAFLYLGALAYTWVWSLWEVGFSPVDLLPRDFGPTLLGILVALTIPVLRRMETRR TLRGTV

Protein Names:Recommended name: Glycerol dehydrogenase small subunit EC= 1.1.99.22 Alternative name(s): D-arabitol dehydrogenase small subunit Short name= ARDH D-sorbitol dehydrogenase subunit sldB Short name= SLDH Gluconate/polyol

Gene Names:Name:sldB Synonyms:g5dhA Ordered Locus Names:GOX0855

Expression Region:1-126

Sequence Info:full length protein

View full details