Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gibberella zeae Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)

Recombinant Gibberella zeae Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)

SKU:CSB-CF670138GGB

Regular price ¥271,500 JPY
Regular price Sale price ¥271,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Uniprot NO.:Q4ICM9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VSDKPQPETVQATPQPAPSNVLPPLDWNSFFKLRVKRRRYQMLFSITNGIFAGSGGAIFL STGSAEPIISQIPLDPFMTLGLMTLAFSGLGWLSGPSVGNQVFYILNRQWKKQMTQKEAI FFERIKRNRVDPTNSSANNPVPDFYGEKISSVAGYRSWLKDQKAFNKKKTANFV

Protein Names:Recommended name: Presequence translocated-associated motor subunit PAM17, mitochondrial

Gene Names:Name:PAM17 ORF Names:FG05029

Expression Region:62-235

Sequence Info:full length protein

View full details