Gene Bio Systems
Recombinant Gibberella zeae Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)
Recombinant Gibberella zeae Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)
SKU:CSB-CF677970GGB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Uniprot NO.:Q4I8P5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AADMNSIGMRYRNLMNKHPFLMFGLPFLTVIVAGSFVLTPATAVRYERYDRKVRQMTKDE ELNVRRSARKVDMKEEYYRLAGKDLDDWEQKRVKRLPGENDGLL
Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial
Gene Names:Name:COX16 ORF Names:FG06413
Expression Region:12-115
Sequence Info:full length protein
