Recombinant Gibberella zeae Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)

SKU: CSB-CF677970GGB

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Uniprot NO.:Q4I8P5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AADMNSIGMRYRNLMNKHPFLMFGLPFLTVIVAGSFVLTPATAVRYERYDRKVRQMTKDE ELNVRRSARKVDMKEEYYRLAGKDLDDWEQKRVKRLPGENDGLL

Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial

Gene Names:Name:COX16 ORF Names:FG06413

Expression Region:12-115

Sequence Info:full length protein