Gene Bio Systems
Recombinant Geobacter bemidjiensis NADH-quinone oxidoreductase subunit A 1(nuoA1)
Recombinant Geobacter bemidjiensis NADH-quinone oxidoreductase subunit A 1(nuoA1)
SKU:CSB-CF479508GFN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)
Uniprot NO.:B5E973
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPVTAQQVELIPLAIYTLFAVGLIGILLLAARYLGSGKETSEKHIPFESGMVPTGNARHA SQVPFYLIAIFFIVFDVEGAFILAWATSWDLLGIPGLVHITLFITVLLLGLVWLWMKGGL DWGPSAMRARGKRS
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 1 NDH-1 subunit A 1 NUO1 1
Gene Names:Name:nuoA1 Ordered Locus Names:Gbem_0179
Expression Region:1-134
Sequence Info:full length protein
