
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacillus kaustophilus (strain HTA426)
Uniprot NO.:Q5L2R6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSIKYSSKINKIRTFALSLIFIGVIVMYLGLFFRTSPVIMTLFMLFGMLFLVASGIVYFW IGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKKRKS
Protein Names:Recommended name: UPF0295 protein GK0479
Gene Names:Ordered Locus Names:GK0479
Expression Region:1-117
Sequence Info:full length protein
You may also like
-
Recombinant Geobacillus kaustophilus UPF0344 protein GK0697(GK0697)
- Regular price
- ¥168,400 JPY
- Sale price
- ¥168,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Geobacillus kaustophilus UPF0059 membrane protein GK3374(GK3374)
- Regular price
- ¥176,500 JPY
- Sale price
- ¥176,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Geobacillus sp. UPF0295 protein GWCH70_0499 (GWCH70_0499)
- Regular price
- ¥168,700 JPY
- Sale price
- ¥168,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Geobacillus kaustophilus UPF0756 membrane protein GK2737(GK2737)
- Regular price
- ¥172,600 JPY
- Sale price
- ¥172,600 JPY
- Regular price
-
- Unit price
- per
Sold out