Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geobacillus kaustophilus Protease prsW(prsW)

Recombinant Geobacillus kaustophilus Protease prsW(prsW)

SKU:CSB-CF702540GAAA

Regular price ¥280,700 JPY
Regular price Sale price ¥280,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Geobacillus kaustophilus (strain HTA426)

Uniprot NO.:Q5KXR9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSLISAGVAPGVALLSYFYLKDEYEAEPLSFVLRMFLFGVLLVFPIMFIQYVLAAEGIV ASPAAEAFLSAALLEEFVKWFVVYFFVYDHDEFDEPYDGIVYSASVSLGFATLENILYLL ANGVETAIARALLPVSSHALFSVIMGFYFGKAKFAVKKRRYYLWASFLLPFFLHGVYDWL LLAKERWGYYMGLFMLALWWAALRKVKQAKGYARPQAVPPVKSQA

Protein Names:Recommended name: Protease prsW EC= 3.4.-.- Alternative name(s): Protease responsible for activating sigma-W

Gene Names:Name:prsW Ordered Locus Names:GK2232

Expression Region:1-225

Sequence Info:full length protein

View full details