Skip to product information
1 of 1

Gene Bio Systems

Recombinant Fusobacterium nucleatum subsp. nucleatum Membrane protein insertase YidC(yidC)

Recombinant Fusobacterium nucleatum subsp. nucleatum Membrane protein insertase YidC(yidC)

SKU:CSB-CF823280FDQ

Regular price ¥276,900 JPY
Regular price Sale price ¥276,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

Uniprot NO.:Q8RHA4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSYIYNLLKQFLAFLLNTTDKYVGNFGISIIIVTILIKIILLPLTLKQDKSMKEMKKLQP ELEKIKQKYANDKQMLNIKTMELYREHKVNPLGGCLPILVQLPILFALFGVLRSGIIPAD SSFLWMRLADPDPFYVLPVLNGAVSFLQQKLMGTSDNAQMKNMMYVFPIMMIVISYRMPS GLQLYWLTSSLIAVIQQYFIMKKGA

Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC

Gene Names:Name:yidC Ordered Locus Names:FN0004

Expression Region:1-205

Sequence Info:full length protein

View full details