
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:Q8ZIX7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIYGVFALKSGPAGWEGF VSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKMGPEPMIKALWVVTVVA SAIILAVALL
Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein
Gene Names:Name:frdC Ordered Locus Names:YPO0358, y0615, YP_0513
Expression Region:1-130
Sequence Info:full length protein
You may also like
-
Recombinant Fumarate reductase subunit C(frdC)
- Regular price
- ¥218,800 JPY
- Sale price
- ¥218,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Fumarate reductase subunit D(frdD)
- Regular price
- ¥217,000 JPY
- Sale price
- ¥217,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Yersinia pestis Fumarate reductase subunit C(frdC)
- Regular price
- ¥218,800 JPY
- Sale price
- ¥218,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Yersinia pestis bv. Antiqua Fumarate reductase subunit C(frdC)
- Regular price
- ¥218,800 JPY
- Sale price
- ¥218,800 JPY
- Regular price
-
- Unit price
- per
Sold out