Gene Bio Systems
Recombinant Francisella tularensis subsp. holarctica Protein CrcB homolog(crcB)
Recombinant Francisella tularensis subsp. holarctica Protein CrcB homolog(crcB)
SKU:CSB-CF641907FCO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Francisella tularensis subsp. holarctica (strain LVS)
Uniprot NO.:Q2A5R2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKL FNEDVSTYVRFLLVTGFLGGFTTFSSFSLDILNLLQRGEIFIAIGYIWLVS
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:FTL_0141
Expression Region:1-111
Sequence Info:full length protein
