Recombinant Francisella tularensis subsp. holarctica  Protein CrcB homolog(crcB)

Recombinant Francisella tularensis subsp. holarctica Protein CrcB homolog(crcB)

CSB-CF417789FDV
Regular price
¥169,600 JPY
Sale price
¥169,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)

Uniprot NO.:A7N9H7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKL FNEDVSTYVRFLLVTGFLGGFTTFSSFSLDILNLLQRGEIFIAIGYIWLVS

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:FTA_0153

Expression Region:1-111

Sequence Info:full length protein

Your list is ready to share