Skip to product information
1 of 1

Gene Bio Systems

Recombinant Folate transporter FolT(folT)

Recombinant Folate transporter FolT(folT)

SKU:CSB-CF809668FMR

Regular price ¥273,100 JPY
Regular price Sale price ¥273,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus mutans

Uniprot NO.:Q8DV98

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNTMFKSPKLSPQRLVTLAMLIALAFAIGKLSIPIIPQQLIISPTFIVNVMIGMIGGPIW AFISLAILDIVDNLSSGAGNFIIWWTLLEAVQGLFYGLFFYQKSLSWTNKKDWLHVTIAT AIIMLIGSFIFTPLLVQIYYGVPFWAQFAAGRWLKIFEIPIRILVTMAIMPQLQRIPELR KLANFK

Protein Names:Recommended name: Folate transporter FolT Alternative name(s): Folate ECF transporter S component FolT

Gene Names:Name:folT Ordered Locus Names:SMU_600c

Expression Region:1-186

Sequence Info:full length protein

View full details