Skip to product information
1 of 1

Gene Bio Systems

Recombinant Fagopyrum esculentum subsp. ancestrale ATP synthase subunit a, chloroplastic(atpI)

Recombinant Fagopyrum esculentum subsp. ancestrale ATP synthase subunit a, chloroplastic(atpI)

SKU:CSB-CF451203FEC

Regular price ¥279,700 JPY
Regular price Sale price ¥279,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Fagopyrum esculentum subsp. ancestrale (Wild buckwheat)

Uniprot NO.:B2XWN7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLLSCSINTLRGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLSSAAIAVRN PQTIPTDGQNFFEYVLEFIRDVSKTQIGEEYRPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Protein Names:Recommended name: ATP synthase subunit a, chloroplastic Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit IV

Gene Names:Name:atpI

Expression Region:1-247

Sequence Info:full length protein

View full details