Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli UPF0059 membrane protein yebN(yebN)

Recombinant Escherichia coli UPF0059 membrane protein yebN(yebN)

SKU:CSB-CF533141ENP

Regular price ¥274,200 JPY
Regular price Sale price ¥274,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

Uniprot NO.:B1J0R7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG

Protein Names:Recommended name: UPF0059 membrane protein yebN

Gene Names:Name:yebN Ordered Locus Names:EcolC_1811

Expression Region:1-188

Sequence Info:full length protein

View full details