Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli UPF0056 inner membrane protein yhgN(yhgN)

Recombinant Escherichia coli UPF0056 inner membrane protein yhgN(yhgN)

SKU:CSB-CF354285ENV

Regular price ¥271,300 JPY
Regular price Sale price ¥271,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P67143

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNEIISAAVLLILIMDPLGNLPIFMSVLKHTEPKRRRAIMVRELLIALLVMLVFLFAGEK ILAFLSLRAETVSISGGIILFLIAIKMIFPSASGNSSGLPAGEEPFIVPLAIPLVAGPTI LATLMLLSHQYPNQMGHLVIALLLAWGGTFVILLQSSLFLRLLGEKGVNALERLMGLILV MMATQMFLDGIRMWMKG

Protein Names:Recommended name: UPF0056 inner membrane protein yhgN

Gene Names:Name:yhgN Ordered Locus Names:b3434, JW3397

Expression Region:1-197

Sequence Info:full length protein

View full details