Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Uncharacterized protein ytcA(ytcA)

Recombinant Escherichia coli Uncharacterized protein ytcA(ytcA)

SKU:CSB-CF631080EGW

Regular price ¥250,800 JPY
Regular price Sale price ¥250,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain UTI89 / UPEC)

Uniprot NO.:Q1R3H8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CSLSPAIPVIGAYYPGWFFCAIASLILTLITRRIIQRTNINLAFVGIIYTALFALYAMLF WLAFF

Protein Names:Recommended name: Uncharacterized protein ytcA

Gene Names:Name:ytcA Ordered Locus Names:UTI89_C4678

Expression Region:27-91

Sequence Info:full length protein

View full details