
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P0AFX7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVM AAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQH YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDY ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ
Protein Names:Recommended name: Sigma-E factor negative regulatory protein
Gene Names:Name:rseA Synonyms:mclA, yfiJ Ordered Locus Names:b2572, JW2556
Expression Region:1-216
Sequence Info:full length protein
You may also like
-
Recombinant Sigma-E factor negative regulatory protein(rseA)
- Regular price
- ¥231,600 JPY
- Sale price
- ¥231,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Sigma-E factor regulatory protein RseC(rseC)
- Regular price
- ¥222,700 JPY
- Sale price
- ¥222,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Regulator of sigma E protease(rseP)
- Regular price
- ¥268,200 JPY
- Sale price
- ¥268,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Regulator of sigma E protease(rseP)
- Regular price
- ¥268,200 JPY
- Sale price
- ¥268,200 JPY
- Regular price
-
- Unit price
- per
Sold out