Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Putative inactive ferrous iron permease EfeU(efeU)

Recombinant Escherichia coli Putative inactive ferrous iron permease EfeU(efeU)

SKU:CSB-CF301164ENV

Regular price ¥290,400 JPY
Regular price Sale price ¥290,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P75901

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFVPFLIMLREGLEAALIVSLIASYLKRTQRGMXDCVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA

Protein Names:Recommended name: Putative inactive ferrous iron permease EfeU Alternative name(s): Putative Fe(2+) ion permease EfeU

Gene Names:Name:efeU Synonyms:ycdN Ordered Locus Names:b4490, JW5141/JW1002 ORF Names:b1016/b1017

Expression Region:1-276

Sequence Info:full length protein

View full details