Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli protein FimH(fimH)

Recombinant Escherichia coli protein FimH(fimH)

SKU:CSB-EP362349ENV

Regular price ¥165,200 JPY
Regular price Sale price ¥165,200 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: fimH

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli (strain K12)

Delivery time: 3-7 business days

Uniprot ID: P08191

AA Sequence: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

Tag info: N-terminal 6xHis-GST-tagged

Expression Region: 22-300aa

Protein length: Full Length of Mature Protein

MW: 59.1 kDa

Alternative Name(s):

Relevance: Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.

Reference: Three fim genes required for the regulation of length and mediation of adhesion of Escherichia coli type 1 fimbriae.Klemm P., Christiansen G.Mol. Gen. Genet. 208:439-445(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details