Gene Bio Systems
Recombinant Escherichia coli Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)
Recombinant Escherichia coli Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)
SKU:CSB-CF305171ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P76474
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnF Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Gene Names:Name:arnF Synonyms:pmrM, yfbJ Ordered Locus Names:b2258, JW5373
Expression Region:1-128
Sequence Info:full length protein
