Skip to product information
1 of 1

GeneBio Systems

Recombinant Escherichia coli O157:H7 Translocated intimin receptor Tir (tir), partial

Recombinant Escherichia coli O157:H7 Translocated intimin receptor Tir (tir), partial

SKU:C6UYL8

Regular price ¥158,900 JPY
Regular price Sale price ¥158,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: C6UYL8

Gene Names: tir

Alternative Name(s): Secreted effector protein Tir

Abbreviation: Recombinant E.coli O157: H7 tir protein, partial

Organism: Escherichia coli O157: H7 (strain TW14359 / EHEC)

Source: E.coli

Expression Region: 252-362aa

Protein Length: Extracellular Domain

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG

MW: 27.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The Extracellular domain region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion

Reference: "Analysis of the genome of the Escherichia coli O157: H7 2006 spinach-associated outbreak isolate indicates candidate genes that may enhance virulence."Kulasekara B.R., Jacobs M., Zhou Y., Wu Z., Sims E., Saenphimmachak C., Rohmer L., Ritchie J.M., Radey M., McKevitt M., Freeman T.L., Hayden H., Haugen E., Gillett W., Fong C., Chang J., Beskhlebnaya V., Waldor M.K. Miller S.I.Infect. Immun. 77: 3713-3721(2009)

Function: Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The extracellular region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion (By similarity).

View full details