Recombinant Escherichia coli Mannose-6-phosphate isomerase(manA)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Escherichia coli Mannose-6-phosphate isomerase(manA)

CSB-EP014754ENV
Regular price
¥159,200 JPY
Sale price
¥159,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P00946

Gene Names: manA

Organism: Escherichia coli (strain K12)

AA Sequence: MQKLINSVQNYAWGSKTALTELYGMENPSSQPMAELWMGAHPKSSSRVQNAAGDIVSLRDVIESDKSTLLGEAVAKRFGELPFLFKVLCAAQPLSIQVHPNKHNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSEIVSLLQPVAGAHPAIAHFLQQPDAERLSELFASLLNMQGEEKSRALAILKSALDSQQGEPWQTIRLISEFYPEDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEAKPANQLLTQPVKQGAELDFPIPVDDFAFSLHDLSDKETTISQQSAAILFCVEGDATLWKGSQQLQLKPGESAFIAANESPVTVKGHGRLARVYNKL

Expression Region: 1-391aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 58.8 kDa

Alternative Name(s): PhosphohexomutasePhosphomannose isomerase ;PMI

Relevance: Involved in the conversion of glucose to GDP-L-fucose, which can be converted to L-fucose, a capsular polysaccharide.

Reference: Robison K., O'Keeffe T., Church G.M. Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli.Zhang J., Sprung R., Pei J., Tan X., Kim S., Zhu H., Liu C.F., Grishin N.V., Zhao Y.Mol. Cell. Proteomics 8:215-225(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Escherichia coli Glucose-6-phosphate 1-dehydrogenase(zwf),partial
    Regular price
    ¥159,200 JPY
    Sale price
    ¥159,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Phosphoserine phosphatase(serB)
    Regular price
    ¥159,200 JPY
    Sale price
    ¥159,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Aerobic glycerol-3-phosphate dehydrogenase(glpD)
    Regular price
    ¥159,200 JPY
    Sale price
    ¥159,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Bifunctional protein HldE(hldE)
    Regular price
    ¥159,200 JPY
    Sale price
    ¥159,200 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share