Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Lipopolysaccharide export system protein LptA(lptA)

Recombinant Escherichia coli Lipopolysaccharide export system protein LptA(lptA)

SKU:CSB-YP360010ENV

Regular price ¥209,200 JPY
Regular price Sale price ¥209,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P0ADV1

Gene Names: lptA

Organism: Escherichia coli (strain K12)

AA Sequence: VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Expression Region: 28-185aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 19.3 kDa

Alternative Name(s):

Relevance: Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. May form a bridge between the inner mbrane and the outer mbrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Reference: Non-essential KDO biosynthesis and new essential cell envelope biogenesis genes in the Escherichia coli yrbG-yhbG locus.Sperandeo P., Pozzi C., Deho G., Polissi A.Res. Microbiol. 157:547-558(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details