Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Inner membrane protein yqjF(yqjF)

Recombinant Escherichia coli Inner membrane protein yqjF(yqjF)

SKU:CSB-CF331583ENV

Regular price ¥263,300 JPY
Regular price Sale price ¥263,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P42619

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKLEDVGVLVARILMPILFITAGWGKITGYAGTQQYMEAMGVPGFMLPLVILLEFGGGL AILFGFLTRTTALFTAGFTLLTAFLFHSNFAEGVNSLMFMKNLTISGGFLLLAITGPGAY SIDRLLNKKW

Protein Names:Recommended name: Inner membrane protein yqjF

Gene Names:Name:yqjF Ordered Locus Names:b3101, JW5850

Expression Region:1-130

Sequence Info:full length protein

View full details