Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Inner membrane protein YmgF(ymgF)

Recombinant Escherichia coli Inner membrane protein YmgF(ymgF)

SKU:CSB-CF349041ENV

Regular price ¥252,100 JPY
Regular price Sale price ¥252,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P58034

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR LRERLVNHRDQQ

Protein Names:Recommended name: Inner membrane protein YmgF

Gene Names:Name:ymgF Ordered Locus Names:b4520, JW1156

Expression Region:1-72

Sequence Info:full length protein

View full details