Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Homoserine-homoserine lactone efflux protein(rhtB)

Recombinant Escherichia coli Homoserine-homoserine lactone efflux protein(rhtB)

SKU:CSB-CF360364ENV

Regular price ¥275,800 JPY
Regular price Sale price ¥275,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P0AG34

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLEWWFAYLLTSIILSLSPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVG LGTLFSRSVIAFEVLKWAGAAYLIWLGIQQWRAAGAIDLKSLASTQSRRHLFQRAVFVNL TNPKSIVFLAALFPQFIMPQQPQLMQYIVLGVTTIVVDIIVMIGYATLAQRIALWIKGPK QMKALNKIFGSLFMLVGALLASARHA

Protein Names:Recommended name: Homoserine/homoserine lactone efflux protein

Gene Names:Name:rhtB Synonyms:yigK Ordered Locus Names:b3824, JW5585

Expression Region:1-206

Sequence Info:full length protein

View full details