Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Disulfide bond formation protein B(dsbB)

Recombinant Escherichia coli Disulfide bond formation protein B(dsbB)

SKU:CSB-CF363883ENV

Regular price ¥272,300 JPY
Regular price Sale price ¥272,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P0A6M2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWV PQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR

Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase

Gene Names:Name:dsbB Synonyms:roxB, ycgA Ordered Locus Names:b1185, JW5182

Expression Region:1-176

Sequence Info:full length protein

View full details