Gene Bio Systems
Recombinant Escherichia coli Cytochrome o ubiquinol oxidase protein CyoD(cyoD)
Recombinant Escherichia coli Cytochrome o ubiquinol oxidase protein CyoD(cyoD)
SKU:CSB-CF359628ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P0ABJ6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLV HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH
Protein Names:Recommended name: Cytochrome o ubiquinol oxidase protein CyoD Short name= Ubiquinol oxidase chain D
Gene Names:Name:cyoD Ordered Locus Names:b0429, JW0419
Expression Region:1-109
Sequence Info:full length protein
