Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Cell division protein ZipA(zipA)

Recombinant Escherichia coli Cell division protein ZipA(zipA)

SKU:CSB-EP303519ENV

Regular price ¥157,100 JPY
Regular price Sale price ¥157,100 JPY
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P77173

Gene Names: zipA

Organism: Escherichia coli (strain K12)

AA Sequence: MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA

Expression Region: 1-328aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 52.5 kDa

Alternative Name(s):

Relevance: Interacts directly with the cell division protein FtsZ. Probable receptor for the septal ring structure, may anchor it to the inner-mbrane.

Reference: Direct binding of FtsZ to ZipA, an essential component of the septal ring structure that mediates cell division in E. coli.Hale C.A., de Boer P.A.J.Cell 88:175-185(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)