Gene Bio Systems
Recombinant Escherichia coli Beta-lactamase TEM(bla)
Recombinant Escherichia coli Beta-lactamase TEM(bla)
SKU:CSB-EP352353ENL
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P62593
Gene Names: bla
Organism: Escherichia coli
AA Sequence: HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Expression Region: 24-286aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 44.9 kDa
Alternative Name(s): IRT-4PenicillinaseTEM-1TEM-16/CAZ-7TEM-2TEM-24/CAZ-6TEM-3TEM-4TEM-5TEM-6TEM-8/CAZ-2
Relevance: T-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
Reference: Beta-lactamase TEM1 of E. coli. Crystal structure determination at 2.5-A resolution.Jelsch C., Lenfant F., Masson J.-M., Samama J.-P.FEBS Lett. 299:135-142(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
