
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P69441
Gene Names: adk
Organism: Escherichia coli (strain K12)
AA Sequence: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Expression Region: 1-214aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 27.6 kDa
Alternative Name(s): ATP-AMP transphosphorylase
Relevance: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Reference: Eukaryotic Mr 83,000 heat shock protein has a homologue in Escherichia coli.Bardwell J.C.A., Craig E.A.Proc. Natl. Acad. Sci. U.S.A. 84:5177-5181(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli Dephospho-CoA kinase(coaE)
- Regular price
- ¥104,200 JPY
- Sale price
- ¥104,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Adenylate kinase 2, mitochondrial(AK2)
- Regular price
- ¥81,400 JPY
- Sale price
- ¥81,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)
- Regular price
- ¥104,200 JPY
- Sale price
- ¥104,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Cytidylate kinase(cmk)
- Regular price
- ¥122,400 JPY
- Sale price
- ¥122,400 JPY
- Regular price
-
- Unit price
- per
Sold out