Skip to product information
1 of 1

Gene Bio Systems

Recombinant Erwinia tasmaniensis UPF0756 membrane protein ETA_17460 (ETA_17460)

Recombinant Erwinia tasmaniensis UPF0756 membrane protein ETA_17460 (ETA_17460)

SKU:CSB-CF456983ENB

Regular price ¥267,500 JPY
Regular price Sale price ¥267,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Erwinia tasmaniensis (strain DSM 17950 / Et1/99)

Uniprot NO.:B2VET5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFDLTLAIMLFLAALSYFSHNITVTIALLVLIVIRMTPLQQTFPWIEKQGMTVGIIILTI GVMAPIASGTIPSSTLMHSFLHWKSLTAIAIGIFVSWLGGRGVTLMSTQPTVVGGLLIGT IIGVSLFRGVPVGPLIAAGLLSLMLGKG

Protein Names:Recommended name: UPF0756 membrane protein ETA_17460

Gene Names:Ordered Locus Names:ETA_17460

Expression Region:1-148

Sequence Info:full length protein

View full details