Skip to product information
1 of 1

Gene Bio Systems

Recombinant Erwinia carotovora subsp. atroseptica Arginine exporter protein ArgO(argO)

Recombinant Erwinia carotovora subsp. atroseptica Arginine exporter protein ArgO(argO)

SKU:CSB-CF724811EAAB

Regular price ¥270,700 JPY
Regular price Sale price ¥270,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)

Uniprot NO.:Q6D090

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWAVYLQGVLLGAAMILPLGPQNAFVMNQGIRRQYHLMVALLCAVSDMVLISAGIFGGSA LLNQSSLLLGAVTCGGVAFLLWFGWGAMKTAFSKNIALTSADVMKQSRWRIIATMLAVTW LNPHVYLDTFVVLGSLGSQFADDARRWFALGTMTASFTWFFALALLAAWLAPWLNTPRVQ RVINFFVGMVMWGIALQLARHGWQ

Protein Names:Recommended name: Arginine exporter protein ArgO

Gene Names:Name:argO Ordered Locus Names:ECA3909

Expression Region:1-204

Sequence Info:full length protein

View full details