Skip to product information
1 of 1

Gene Bio Systems

Recombinant ER lumen protein retaining receptor(erd-2)

Recombinant ER lumen protein retaining receptor(erd-2)

SKU:CSB-CF717203CXX

Regular price ¥278,500 JPY
Regular price Sale price ¥278,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caenorhabditis briggsae

Uniprot NO.:Q611C8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFRITADLAHAVAIVILLLKIWKSRSCEGISGRSQILFAVTFFTRYLDLFTSFYSLYN TVMKVLFLAGSIGTVYLMWVKFKATYDRNNDTFRIEFLVIPSIILALIINHEFMFMEVMW TFSIYLEAVAIMPQLFMLSRTGNAETITAHYLFALGSYRFLYIFNWVYRYYTESFFDPIA VVAGIVQTVLYADFFYLYITRVIQSNRQFEMSA

Protein Names:Recommended name: ER lumen protein retaining receptor

Gene Names:Name:erd-2 ORF Names:CBG17162

Expression Region:1-213

Sequence Info:full length protein

View full details