Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine herpesvirus 1 Glycoprotein N (10)

Recombinant Equine herpesvirus 1 Glycoprotein N (10)

SKU:CSB-CF306199EFO

Regular price ¥252,200 JPY
Regular price Sale price ¥252,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine herpesvirus 1 (strain V592) (EHV-1) (Equine abortion virus)

Uniprot NO.:P84449

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DPGVKQRIDVAREEERRDFWHAACSGHGFPITTPSTAAILFYVSLLAVGVAVACQAYRAV LRIVTLEMLQHLH

Protein Names:Recommended name: Glycoprotein N Short name= gN

Gene Names:Ordered Locus Names:10

Expression Region:28-100

Sequence Info:full length protein

View full details