Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine herpesvirus 1 Envelope protein UL45 homolog (15)

Recombinant Equine herpesvirus 1 Envelope protein UL45 homolog (15)

SKU:CSB-CF336160EFN

Regular price ¥282,100 JPY
Regular price Sale price ¥282,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine herpesvirus 1 (strain Kentucky D) (EHV-1) (Equine abortion virus)

Uniprot NO.:P36323

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGDPTAAMEDYKLLQLETATVDAQAPPLPTKTVPVFAPPLSTPPQPNELVYTKRRRTKR KAKCRCLFFTMGMFALGVLMTTAILVSTFILTVPIGALRTAPCPAETFGLGDECVRPVLL NASSNTRNISGVGAVCEEYSEMAASNGTAGLIMSLLDCLNVGDSESVMNKLNLDDTQLAY CNVPSFAECYTKGFGVCYAARPLSPLGELIYKARQALRLDHIIPFPR

Protein Names:Recommended name: Envelope protein UL45 homolog

Gene Names:Ordered Locus Names:15

Expression Region:1-227

Sequence Info:full length protein

View full details